PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TALE
Protein Properties Length: 374aa    MW: 41682.7 Da    PI: 6.5038
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012735.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093023362155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps++++  LA+++gL+++q+ +WF N+R ++
  CCG012735.1 302 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 336
                  569*****************************885 PP

2ELK37.74.3e-13256277122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlr YsgyLgsLkqEF+
  CCG012735.1 256 ELKGQLLRRYSGYLGSLKQEFM 277
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-13116164IPR005540KNOX1
PfamPF037901.8E-15118160IPR005540KNOX1
SMARTSM012565.1E-26169220IPR005541KNOX2
PfamPF037911.4E-20172219IPR005541KNOX2
SMARTSM011888.6E-8256277IPR005539ELK domain
PfamPF037891.9E-10256277IPR005539ELK domain
PROSITE profilePS5121310.912256276IPR005539ELK domain
PROSITE profilePS5007112.989276339IPR001356Homeobox domain
SuperFamilySSF466891.33E-19278353IPR009057Homeodomain-like
SMARTSM003897.4E-13278343IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-28281341IPR009057Homeodomain-like
CDDcd000861.81E-12288340No hitNo description
PfamPF059206.8E-17296335IPR008422Homeobox KN domain
PROSITE patternPS000270314337IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEGGGGDGGS STTSCMMAFG DNSNGLCPMM MMTPLMSSSS SAHHQHHHHN HRVNEGDSSI  60
SNTLFLPLPP TNNQGHNRIH SNASGSSSMI IDDHNHNNTV TATGCYFMDN NDGSGSSVKA  120
KIMAHPHYHR LLAAYANCQK VKNGAESPPE VVARLEEACA SAASMPPANT GCIGEDPALD  180
QFMEAYCEML TKYEQELSKP LKEAMLFLQR VECQFKALTL SSPISGCGDG NDRNVSSEEE  240
VDVNNNFIDP QAEDQELKGQ LLRRYSGYLG SLKQEFMKKR KKGKLPKEAR QQLLDWWSRH  300
YKWPYPSESQ KLALAESTGL DQKQINNWFI NQRKRHWKPS EDMQFVVMDA GHPHYYMDNV  360
LGNPFPMDIS PTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1271280LKQEFMKKRK
2277281KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6849370.0AY684937.1 Populus balsamifera subsp. trichocarpa x Populus deltoides homeobox transcription factor KN2 (Kn2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002564.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-152HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ5XLC90.0Q5XLC9_POPCN; Homeodomain protein ARBORKNOX1
STRINGVIT_10s0116g00190.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor